TPP1 anticorps (Middle Region)

N° du produit ABIN3044554

Détail du produit anti-TPP1 anticorps

Antigène: TPP1 (Tripeptidyl Peptidase I (TPP1))

Épitope: AA 227-261, Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPP1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Tripeptidyl-peptidase 1(TPP1) detection. Tested with WB, IHC-P in Human.

Séquence: CAQFLEQYFH DSDLAQFMRL FGGNFAHQAS VARVV

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Tripeptidyl-peptidase 1(TPP1) detection. Tested with WB, IHC-P in Human.
Gene Name: tripeptidyl peptidase I
Protein Name: Tripeptidyl-peptidase 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human TPP1 (227-261aa CAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur TPP1

Antigène: TPP1 (Tripeptidyl Peptidase I (TPP1))

Autre désignation: TPP1 (TPP1 Produits)

Synonymes: anticorps cln2, anticorps fa01b09, anticorps im:7149243, anticorps wu:fa01b09, anticorps CLN2, anticorps LPIC, anticorps TPP-1, anticorps TPP-I, anticorps Cln2, anticorps tripeptidyl peptidase I, anticorps tripeptidyl-peptidase 1, anticorps tripeptidyl peptidase 1, anticorps tpp1, anticorps NAEGRDRAFT_78259, anticorps MCYG_00184, anticorps MGYG_05881, anticorps MGYG_00757, anticorps TPP1, anticorps Tpp1

Sujet: Tripeptidyl-peptidase 1, also known as Lysosomal pepstatin-insensitive protease, is an enzyme that in humans is encoded by the TPP1 gene. This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome.

Synonyms: Cell growth inhibiting gene 1 protein antibody|Cell growth-inhibiting gene 1 protein antibody|Ceroid lipofuscinosis neuronal 2 antibody|Ceroid lipofuscinosis neuronal 2 late infantile (Jansky Bielschowsky disease) antibody|Ceroid lipofuscinosis neuronal 2 late infantile antibody|CLN 2 antibody|CLN2 antibody|GIG 1 antibody|GIG1 antibody|Growth inhibiting protein 1 antibody|LPIC antibody| Lysosomal pepstatin insensitive protease antibody|Lysosomal pepstatin-insensitive protease antibody|MGC21297 antibody|TPP 1 antibody| TPP I antibody|TPP-1 antibody|TPP-I antibody|Tpp1 antibody|TPP1_HUMAN antibody|TPPI antibody|Tripeptidyl aminopeptidase antibody| Tripeptidyl peptidase I antibody|Tripeptidyl-peptidase 1 antibody|Tripeptidyl-peptidase I antibody

ID gène: 1200

UniProt: O14773

Pathways: Cycle Cellulaire, ER-Nucleus Signaling