VASP anticorps (N-Term)

N° du produit ABIN4886759

Détail du produit anti-VASP anticorps

Antigène: VASP (Vasodilator-Stimulated phosphoprotein (VASP))

Épitope: AA 78-114, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VASP est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Vasodilator-stimulated phosphoprotein(VASP) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: NFHQWRDARQ VWGLNFGSKE DAAQFAAGMA SALEALE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Vasodilator-stimulated phosphoprotein(VASP) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: vasodilator-stimulated phosphoprotein
Protein Name: Vasodilator-stimulated phosphoprotein

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human VASP (78-114aa NFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALE), different from the related mouse sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur VASP

Antigène: VASP (Vasodilator-Stimulated phosphoprotein (VASP))

Autre désignation: VASP (VASP Produits)

Synonymes: anticorps vasp, anticorps MGC80889, anticorps wu:fb23b04, anticorps wu:fk84g05, anticorps zgc:110347, anticorps si:dkey-113g17.1, anticorps si:ch211-202c21.1, anticorps DDBDRAFT_0188463, anticorps DDBDRAFT_0229340, anticorps DDB_0188463, anticorps DDB_0229340, anticorps VASP, anticorps vasodilator stimulated phosphoprotein S homeolog, anticorps vasodilator stimulated phosphoprotein b, anticorps protein enabled, anticorps vasodilator-stimulated phosphoprotein, anticorps vasodilator stimulated phosphoprotein a, anticorps vasodilator stimulated phosphoprotein, anticorps vasp.S, anticorps vaspb, anticorps LOC5573842, anticorps CpipJ_CPIJ004706, anticorps CpipJ_CPIJ004707, anticorps vasP, anticorps vasp, anticorps VASP, anticorps vaspa, anticorps Vasp

Sujet: Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions. In the mid-region of the protein, family members have a proline-rich domain that binds SH3 and WW domain-containing proteins. Their C-terminal EVH2 domain mediates tetramerization and binds both G and F actin. VASP is associated with filamentous actin formation and likely plays a widespread role in cell adhesion and motility. VASP may also be involved in the intracellular signaling pathways that regulate integrin-extracellular matrix interactions. VASP is regulated by the cyclic nucleotide-dependent kinases PKA and PKG.

Synonyms: VASP | P50552

ID gène: 7408

UniProt: P50552

Pathways: TCR Signaling, Regulation of Actin Filament Polymerization, Tube Formation