ATG14 anticorps

N° du produit ABIN4950253

L’anticorps anti-ATG14 Polyclonal Lapin est utilisé pour la détection de ATG14 dans des échantillons de Humain et Rat. Il a été validé pour WB, FACS, IF et IHC (p).

Aperçu rapide pour ATG14 anticorps (ABIN4950253)

Antigène: ATG14 (ATG14 Autophagy Related 14 (ATG14))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATG14 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-ATG14 anticorps

Fonction: ATG14L Antibody

Séquence: RDRERFIDKK ERLSRLKSKQ EEFQKEVLKA ME

Purification: Antigen affinity

Immunogène: Amino acids RDRERFIDKKERLSRLKSKQEEFQKEVLKAME of human ATG14L were used as the immunogen for the ATG14L antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ATG14L antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the ATG14L antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur ATG14

Antigène: ATG14 (ATG14 Autophagy Related 14 (ATG14))

Autre désignation: ATG14L

Sujet: ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L), an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, promotes membrane tethering of protein-free liposomes, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8). ATG14 binds to the SNARE core domain of STX17 through its coiled-coil domain, and stabilizes the STX17-SNAP29 binary t-SNARE complex on autophagosomes.

UniProt: Q6ZNE5

Pathways: Autophagy