CSNK1A1 anticorps

N° du produit ABIN4950677

Détail du produit anti-CSNK1A1 anticorps

Antigène: CSNK1A1 (Casein Kinase 1, alpha 1 (CSNK1A1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CSNK1A1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ of human CSNK1A1 were used as the immunogen for the CSNK1A1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CSNK1A1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the CSNK1A1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CSNK1A1

Antigène: CSNK1A1 (Casein Kinase 1, alpha 1 (CSNK1A1))

Autre désignation: CSNK1A1 (CSNK1A1 Produits)

Synonymes: anticorps CK1, anticorps CK1a, anticorps CKIa, anticorps HLCDGP1, anticorps PRO2975, anticorps 2610208K14Rik, anticorps 4632404G05Rik, anticorps 5430427P18Rik, anticorps Csnk1a, anticorps CHUNP6894, anticorps ck1alpha, anticorps wu:fb65a02, anticorps wu:fi30h04, anticorps wu:fj19c11, anticorps zgc:92158, anticorps KER1, anticorps ck1, anticorps CKIALPHA, anticorps CK-II, anticorps CSNK2A1, anticorps CG2028, anticorps CK I, anticorps CK1alpha, anticorps CKI, anticorps CKI alpha, anticorps CKIalpha, anticorps CkIa, anticorps Dmel\\CG2028, anticorps PKA-C, anticorps anon-WO03040301.93, anticorps anon-WO03040301.95, anticorps ck1a, anticorps dmCK1, anticorps dmckI, anticorps l(1)G0492, anticorps casein kinase 1 alpha 1, anticorps casein kinase 1, alpha 1, anticorps keratin 1, anticorps casein kinase 1 alpha 1 L homeolog, anticorps casein kinase 2 alpha 1, anticorps Casein kinase Ialpha, anticorps CSNK1A1, anticorps Csnk1a1, anticorps csnk1a1, anticorps KRT1, anticorps csnk1a1.L, anticorps CSNK2A1, anticorps CkIalpha

Sujet: Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene.

UniProt: P48729

Pathways: Signalisation WNT, Signalisation Hedgehog