Relaxin 1 (RLN1) (AA 1-185) anticorps

N° du produit ABIN519788

Détail du produit

Antigène:

Relaxin 1 (RLN1)

Épitope: AA 1-185

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Fonction: Rabbit polyclonal antibody raised against a full-length human RLN1 protein.

Marque: MaxPab®

Réactivité croisée: Humain

Immunogène:

immunogen: RLN1 (NP_008842.1, 1 a.a. ~ 185 a.a) full-length human protein.

Immunogen Sequence: MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions: For Research Use only

Stockage

Buffer: In 1x PBS, pH 7.4

Conseil sur la manipulation: Aliquot to avoid repeated freezing and thawing.

Stock: -20 °C

Stockage commentaire: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Détail du antigène

Antigène:

Relaxin 1 (RLN1)

Autre désignation: RLN1 (RLN1 Antibody Extrait)

Synonymes: H1, H1RLX, RLXH1, bA12D24.3.1, bA12D24.3.2, Rln, rlx, RELAX, RLX1, RNL1, RLN1, RLX, relaxin 1, RLN1, Rln1

Sujet: Full Gene Name: relaxin 1
Synonyms: H1,RLXH1,bA12D24.3.1,bA12D24.3.2

ID gène: 6013

NCBI Accession: NP_008842, NM_006911