Relaxin 1 (RLN1) (AA 27-185) anticorps

N° du produit ABIN519789

Détail du produit

Antigène:

Relaxin 1 (RLN1)

Épitope: AA 27-185

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Inconjugué

Application: Immunoprecipitation (IP), ELISA, Western Blotting (WB)

Fonction: Mouse monoclonal antibody raised against a full length recombinant RLN1.

Réactivité croisée: Humain

Immunogène:

immunogen: RLN1 (AAH05956.1, 27 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: WKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC

Clone: 1H6

Isotype: IgG2a kappa

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions: For Research Use only

Stockage

Buffer: In 1x PBS, pH 7.4

Conseil sur la manipulation: Aliquot to avoid repeated freezing and thawing.

Stock: -20 °C

Stockage commentaire: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Détail du antigène

Antigène:

Relaxin 1 (RLN1)

Autre désignation: RLN1 (RLN1 Antibody Extrait)

Synonymes: H1, H1RLX, RLXH1, bA12D24.3.1, bA12D24.3.2, Rln, rlx, RELAX, RLX1, RNL1, RLN1, RLX, relaxin 1, RLN1, Rln1

Sujet: Full Gene Name: relaxin 1
Synonyms: H1,RLXH1,bA12D24.3.1,bA12D24.3.2

ID gène: 6013