TUB anticorps (C-Term)

N° du produit ABIN5518797

Détail du produit anti-TUB anticorps

Antigène: TUB (Tubby Homolog (TUB))

Épitope: AA 395-429, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TUB est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Tubby protein homolog(TUB) detection. Tested with WB in Human.

Séquence: VHERVSIRPR NEHETLLARW QNKNTESIIE LQNKT

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Tubby protein homolog(TUB) detection. Tested with WB in Human.
Gene Name: tubby bipartite transcription factor
Protein Name: Tubby protein homolog

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human TUB 1 (395-429aa VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur TUB

Antigène: TUB (Tubby Homolog (TUB))

Autre désignation: TUB (TUB Produits)

Synonymes: anticorps rd5, anticorps tubby, anticorps MGC79522, anticorps TUB, anticorps MGC80126, anticorps MGC84061, anticorps tub, anticorps tubby bipartite transcription factor, anticorps tubby bipartite transcription factor S homeolog, anticorps tub, anticorps TUB, anticorps tub.S, anticorps Tub

Sujet: Tubby protein homolog is a protein that in humans is encoded by the TUB gene. This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.

Synonyms: rd5 | TUB 1 | TUB | P50607

ID gène: 7275

UniProt: P50607

Pathways: Signalisation RTK, Sensory Perception of Sound