ATF6 anticorps (C-Term)

N° du produit ABIN5518809

Détail du produit anti-ATF6 anticorps

Antigène: ATF6 (Activating Transcription Factor 6 (ATF6))

Épitope: AA 597-629, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATF6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Cyclic AMP-dependent transcription factor ATF-6 alpha(ATF6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: AININENVIN GQDYEVMMQI DCQVMDTRIL HIK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Cyclic AMP-dependent transcription factor ATF-6 alpha(ATF6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: activating transcription factor 6
Protein Name: Cyclic AMP-dependent transcription factor ATF-6 alpha

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597-629aa AININENVINGQDYEVMMQIDCQVMDTRILHIK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ATF6

Antigène: ATF6 (Activating Transcription Factor 6 (ATF6))

Autre désignation: ATF6 (ATF6 Produits)

Synonymes: anticorps ATF-6-like, anticorps GB16435, anticorps ATF6, anticorps Atf6, anticorps ATF6A, anticorps 9130025P16Rik, anticorps 9630036G24, anticorps AA789574, anticorps Atf6alpha, anticorps ESTM49, anticorps activating transcription factor 6, anticorps uncharacterized LOC412432, anticorps activating transcription factor 6 S homeolog, anticorps cyclic AMP-dependent transcription factor ATF-6 alpha, anticorps ATF6, anticorps LOC412432, anticorps atf6.S, anticorps LOC100122162, anticorps Atf6

Sujet: ATF6, a member of the leucine zipper protein family, is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules. This gene is mapped to chromosome 1q23.3. ATF6 can constitutively induce the promoter of glucose-regulated protein (grp) genes through activation of the endoplasmic reticulum (ER) stress element (ERSE).

Synonyms: Cyclic AMP-dependent transcription factor ATF-6 alpha | cAMP-dependent transcription factor ATF-6 alpha | Activating transcription factor 6 alpha | ATF6-alpha | Processed cyclic AMP-dependent transcription factor ATF-6 alpha | ATF6 | P18850

ID gène: 22926

UniProt: P18850

Pathways: ER-Nucleus Signaling, Unfolded Protein Response