ErbB2/Her2 anticorps (N-Term)

N° du produit ABIN5518830

Détail du produit anti-ErbB2/Her2 anticorps

Antigène: ErbB2/Her2 (Receptor tyrosine-protein kinase erbB-2 (ErbB2/Her2))

Épitope: AA 29-64, N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ErbB2/Her2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Receptor tyrosine-protein kinase erbB-2(ERBB2) detection. Tested with WB, IHC-P in Human,Rat.

Séquence: TDMKLRLPAS PETHLDMLRH LYQGCQVVQG NLELTY

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Receptor tyrosine-protein kinase erbB-2(ERBB2) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: erb-b2 receptor tyrosine kinase 2
Protein Name: Receptor tyrosine-protein kinase erbB-2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human ErbB 2 (29-64aa TDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTY), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-ErbB2/Her2 (ABIN5518830)

Zhang, Zhang, Ruan, Zhang, He, Gao: "Lapatinib-incorporated lipoprotein-like nanoparticles: preparation and a proposed breast cancer-targeting mechanism." dans: Acta pharmacologica Sinica, Vol. 35, Issue 6, pp. 846-52, (2015) (PubMed).

Tao, Suhua, Juanjuan, Zongzhi, Juan, Dandan: "In vitro study on human cytomegalovirus affecting early pregnancy villous EVT's invasion function." dans: Virology journal, Vol. 8, pp. 114, (2011) (PubMed).

Détails sur ErbB2/Her2

Antigène: ErbB2/Her2 (Receptor tyrosine-protein kinase erbB-2 (ErbB2/Her2))

Autre désignation: ERBB2 (ErbB2/Her2 Produits)

Synonymes: anticorps CD340, anticorps HER-2, anticorps HER-2/neu, anticorps HER2, anticorps MLN 19, anticorps NEU, anticorps NGL, anticorps TKR1, anticorps Erbb-2, anticorps Neu, anticorps c-erbB2, anticorps c-neu, anticorps mKIAA3023, anticorps wu:fv70f10, anticorps zgc:63601, anticorps erb2, anticorps erb-b2 receptor tyrosine kinase 2, anticorps ERBB2, anticorps Erbb2, anticorps erbb2

Sujet: Receptor tyrosine-protein kinase erbB-2, also known as CD340 (cluster of differentiation 340), proto-oncogene Neu, Erbb2 (rodent), or ERBB2 (human), is a protein that in humans is encoded by the ERBB2 gene. And it is also frequently called HER2 (from human epidermal growth factor receptor 2) or HER2/neu. This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

Synonyms: C erb B2/neu protein | Cerb B2/neu protein | CD340 | CD340 antigen | CerbB2 | ERBB2 | HER 2 | HER 2/NEU | HER2 | Herstatin | MLN19 | MLN 19 | NEU | NGL | p185erbB2 | TKR1 | P04626

ID gène: 2064

UniProt: P04626

Pathways: Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Skeletal Muscle Fiber Development