IL-6 Receptor anticorps (C-Term)

N° du produit ABIN5518926

Détail du produit anti-IL-6 Receptor anticorps

Antigène: IL-6 Receptor (IL6R) (Interleukin 6 Receptor (IL6R))

Épitope: AA 379-419, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL-6 Receptor est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Interleukin-6 receptor subunit alpha(IL6R) detection. Tested with WB in Human.

Séquence: LLCIAIVLRF KKTWKLRALK EGKTSMHPPY SLGQLVPERP R

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Interleukin-6 receptor subunit alpha(IL6R) detection. Tested with WB in Human.
Gene Name: interleukin 6 receptor
Protein Name: Interleukin-6 receptor subunit alpha

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human IL6R (379-419aa LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR).

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur IL-6 Receptor

Antigène: IL-6 Receptor (IL6R) (Interleukin 6 Receptor (IL6R))

Autre désignation: IL6R (IL6R Produits)

Synonymes: anticorps IL6R, anticorps il-6ra, anticorps CD126, anticorps IL-6R-1, anticorps IL-6RA, anticorps IL6Q, anticorps IL6RA, anticorps IL6RQ, anticorps gp80, anticorps IL6R1, anticorps Il6ra, anticorps IL-6Ralpha, anticorps IL-6R, anticorps Il6r, anticorps interleukin 6 receptor, anticorps interleukin 6 receptor, alpha, anticorps IL6R, anticorps il6r, anticorps Il6r, anticorps Il6ra

Sujet: Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor. This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9.

Synonyms: Interleukin-6 receptor subunit alpha, IL-6 receptor subunit alpha, IL-6R subunit alpha, IL-6R-alpha, IL-6RA, IL-6R 1, Membrane glycoprotein 80, gp80, CD126, IL6R

ID gène: 3570

UniProt: P08887

Pathways: Signalistation JAK/STAT, Autophagy, Growth Factor Binding, Cancer Immune Checkpoints