CDK4 anticorps (Cyclin-Dependent Kinase 4) (AA 211-303)

Details for Product anti-CDK4 Antibody No. ABIN560295
Antigène
  • zgc:153726
  • CMM3
  • PSK-J3
  • Crk3
  • 8-6
  • CDK4
  • CDK4/6
  • CG5072
  • Cdk4/6
  • DmCdk4
  • Dmel\\CG5072
  • Pk53C
  • Pk?7
  • cdk
  • cdk4
  • cdk4/6
  • dCdk4
  • l(2)05428
  • l(2)0671
  • l(2)k06503
  • l(2)s4639
  • l(2)sh0671
  • xcdk4
  • cyclin-dependent kinase 4
  • cyclin dependent kinase 4
  • Cyclin-dependent kinase 4
  • cyclin-dependent kinase 4 L homeolog
  • cdk4
  • CDK4
  • Cdk4
  • cdk4.L
Épitope
AA 211-303
39
23
15
13
11
11
11
9
8
7
7
7
4
3
3
2
2
2
2
2
2
2
1
1
1
1
Reactivité
Humain
268
136
109
20
9
6
6
5
5
1
1
1
Hôte
Souris
202
96
4
2
1
Clonalité (Clone)
Monoclonal ()
Conjugué
Cet anticorp CDK4 est non-conjugé
17
12
8
5
5
5
5
5
5
5
5
4
2
2
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
249
102
74
54
45
31
25
14
13
13
6
6
5
4
2
2
2
1
Options
Fonction Mouse monoclonal antibody raised against a partial recombinant CDK4.
Immunogène

immunogen: CDK4 (AAH03644, 211 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Clone 8C3
Isotype IgG1 kappa
 Réactivité croisée Humain, Souris
Plasmids, Primers & others Plasmids, Primers & others CDK4 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation CDK4 (CDK4 Antibody Extrait)
Sujet Full Gene Name: cyclin-dependent kinase 4
Synonyms: CMM3,MGC14458,PSK-J3
ID gène 1019
Pathways Cycle Cellulaire, Mitotic G1-G1/S Phases, Regulation of Cell Size
Indications d'application Optimal working dilution should be determined by the investigator.
Commentaires

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Conseil sur la manipulation Aliquot to avoid repeated freezing and thawing.
Stock -20 °C
Stockage commentaire Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Cyclin-Dependent Kinase 4 (CDK4) (AA 211-303) antibody (ABIN560295) CDK4 monoclonal antibody (M07), clone 8C3 Western Blot analysis of CDK4 expression in...
Image no. 2 for anti-Cyclin-Dependent Kinase 4 (CDK4) (AA 211-303) antibody (ABIN560295) Detection limit for recombinant GST tagged CDK4 is approximately 0.3ng/ml as a captur...
Image no. 3 for anti-Cyclin-Dependent Kinase 4 (CDK4) (AA 211-303) antibody (ABIN560295) CDK4 monoclonal antibody (M07), clone 8C3. Western Blot analysis of CDK4 expression i...
Image no. 4 for anti-Cyclin-Dependent Kinase 4 (CDK4) (AA 211-303) antibody (ABIN560295) CDK4 monoclonal antibody (M07), clone 8C3. Western Blot analysis of CDK4 expression i...
Avez-vous cherché autre chose?