Integrin alpha 3a anticorps (Cytoplasmic Domain, N-Term, Non-phosphorylated)

N° du produit ABIN5618629

Cet anticorps anti-Integrin alpha 3a est un anticorps Monoclonal produit chez le Souris, détectant Integrin alpha 3a dans IHC, WB et IHC (fro). Convient pour Humain.

Aperçu rapide pour Integrin alpha 3a anticorps (Cytoplasmic Domain, N-Term, Non-phosphorylated) (ABIN5618629)

Antigène: Integrin alpha 3a

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Integrin alpha 3a est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro))

Clone: 158A3

Détail du produit anti-Integrin alpha 3a anticorps

Épitope: Cytoplasmic Domain, N-Term, Non-phosphorylated

Specificité: Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A

Réactivité croisée (Details): Human

Attributs du produit: Mouse monoclonal Integrin alpha 3A antibody

Immunogène: Integrin alpha 3A antibody was raised in Mouse using a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin as the immunogen.

Isotype: IgG2a

Information d'application

Indications d'application: IHC: 1:100-1:200, WB: 1:100-1:1000

Restrictions: For Research Use only

Stockage

Buffer: Supplied in PBS containing 0.09 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C

Détails sur Integrin alpha 3a

Antigène: Integrin alpha 3a