ATF6 anticorps (AA 597-629)

N° du produit ABIN5647025

Cet anticorps anti-ATF6 est un anticorps Lapin Polyclonal détectant ATF6 dans WB et IHC (p). Adapté pour Humain, Souris et Rat.

Aperçu rapide pour ATF6 anticorps (AA 597-629) (ABIN5647025)

Antigène: ATF6 (Activating Transcription Factor 6 (ATF6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATF6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-ATF6 anticorps

Épitope: AA 597-629

Purification: Antigen affinity purified

Immunogène: Amino acids 597-629 (AININENVINGQDYEVMMQIDCQVMDTRILHIK) from the human protein were used as the immunogen for the ATF6 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ATF6 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ATF6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ATF6

Antigène: ATF6 (Activating Transcription Factor 6 (ATF6))

Autre désignation: ATF6

Sujet: ATF6, a member of the leucine zipper protein family, is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules. This gene is mapped to chromosome 1q23.3. ATF6 can constitutively induce the promoter of glucose-regulated protein (grp) genes through activation of the endoplasmic reticulum (ER) stress element (ERSE).

UniProt: P18850

Pathways: ER-Nucleus Signaling, Unfolded Protein Response