ARHGEF1 anticorps (AA 41-71)

N° du produit ABIN5647328

Cet anticorps anti-ARHGEF1 Polyclonal Lapin (ABIN5647328) détecte spécifiquement ARHGEF1 dans WB, IF, FACS et IHC (p). L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ARHGEF1 anticorps (AA 41-71) (ABIN5647328)

Antigène: ARHGEF1 (rho Guanine Nucleotide Exchange Factor (GEF) 1 (ARHGEF1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARHGEF1 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-ARHGEF1 anticorps

Épitope: AA 41-71

Fonction: ARHGEF1 Antibody

Séquence: EQNSQFQSLE QVKRRPAHLM ALLQHVALQF E

Purification: Antigen affinity

Immunogène: Amino acids 41-71 (EQNSQFQSLEQVKRRPAHLMALLQHVALQFE) from the human protein were used as the immunogen for the ARHGEF1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Differences in protocols and secondary/substrate sensitivity may require the ARHGEF1 antibody to be titrated for optimal performance.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the ARHGEF1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur ARHGEF1

Antigène: ARHGEF1 (rho Guanine Nucleotide Exchange Factor (GEF) 1 (ARHGEF1))

Autre désignation: ARHGEF1

Sujet: Rho guanine nucleotide exchange factor 1, also called p115-RhoGEF, is a protein that in humans is encoded by the ARHGEF1 gene. Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

UniProt: Q92888

Pathways: Neurotrophin Signaling Pathway, Regulation of G-Protein Coupled Receptor Protein Signaling, Thromboxane A2 Receptor Signaling