SIX3 anticorps (AA 1-32)

N° du produit ABIN5647434

Détail du produit anti-SIX3 anticorps

Antigène: SIX3 (Sine Oculis-Related Homeobox 3 (SIX3))

Épitope: AA 1-32

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIX3 est non-conjugé

Application: Western Blotting (WB)

Réactivité croisée (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogène: Amino acids 1-32 (MVFRSPLDLYSSHFLLPNFADSHHRSILLASS) were used as the immunogen for the Six3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Six3 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Six3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur SIX3

Antigène: SIX3 (Sine Oculis-Related Homeobox 3 (SIX3))

Autre désignation: Six3 (SIX3 Produits)

Synonymes: anticorps HPE2, anticorps SIX3, anticorps cb347, anticorps six3.2, anticorps six6, anticorps E130112M24Rik, anticorps Six3a, anticorps Six3alpha, anticorps Six3b, anticorps Six3beta, anticorps six3, anticorps six3.1, anticorps wu:fc10a08, anticorps SIX homeobox 3, anticorps SIX homeobox 3b, anticorps sine oculis-related homeobox 3, anticorps SIX homeobox 3a, anticorps sine oculis homeobox homolog 3, anticorps SIX3, anticorps six3b, anticorps Six3, anticorps six3a, anticorps six3

Sujet: Homeobox protein SIX3 is a protein that in humans is encoded by the SIX3 gene. This gene encodes a member of the sine oculishomeobox transcription factor family. The encoded protein plays a role in eye development. Mutations in SIX3 are the cause of a severe brain malformation, called holoprosencephaly type 2 (HPE2). In HPE2, the brain fails to separate into two hemispheres during early embryonic development, leading to eye and brain malformations, which result in serious facial abnormalities. A mutant zebrafish knockout model has been developed, in which the anterior part of the head was missing due to the atypical increase of Wnt1 activity. When injected with SIX3, these zebrafish embryos were able to successfully develop a normal forebrain. When SIX3 was turned off in mice, resulting in a lack of retina formation due to excessive expression of Wnt8b in the region where the forebrain normally develops. Both of these studies demonstrate the importance of SIX3 activity in brain and eye development.

UniProt: O95343

Pathways: Protein targeting to Nucleus