ACCN1 anticorps (AA 112-147)

N° du produit ABIN5647475

Cet anticorps anti-ACCN1 Polyclonal Lapin (ABIN5647475) détecte spécifiquement ACCN1 dans WB. L’anticorps est réactif avec des échantillons de Humain et Rat.

Aperçu rapide pour ACCN1 anticorps (AA 112-147) (ABIN5647475)

Antigène: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACCN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACCN1 anticorps

Épitope: AA 112-147

Fonction: ACCN1 Antibody / ASIC2

Purification: Antigen affinity

Immunogène: Amino acids 112-147 (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK from the human protein were used as the immunogen for the ACCN1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Differences in protocols and secondary/substrate sensitivity may require the ACCN1 antibody to be titrated for optimal performance.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the ACCN1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur ACCN1

Antigène: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Autre désignation: ACCN1

Sujet: Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.

UniProt: Q16515

Pathways: Sensory Perception of Sound