CYP2D6 anticorps (AA 315-347)

N° du produit ABIN5647528

Détail du produit anti-CYP2D6 anticorps

Antigène: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Épitope: AA 315-347

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP2D6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 315-347 (AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM) from the human protein were used as the immunogen for the CYP2D6 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CYP2D6 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the CYP2D6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CYP2D6

Antigène: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Autre désignation: CYP2D6 (CYP2D6 Produits)

Synonymes: anticorps CPD6, anticorps CYP2D, anticorps CYP2D7AP, anticorps CYP2D7BP, anticorps CYP2D7P2, anticorps CYP2D8P2, anticorps CYP2DL1, anticorps CYPIID6, anticorps P450-DB1, anticorps P450C2D, anticorps P450DB1, anticorps CYP2D42, anticorps MGC64445, anticorps cyp2d2, anticorps cyp2d6-a, anticorps CYP2D6, anticorps cytochrome P450 family 2 subfamily D member 6, anticorps cytochrome P450, family 2, subfamily D, polypeptide 6, anticorps cytochrome 2D6, anticorps cytochrome P450 family 2 subfamily D member 6 S homeolog, anticorps cytochrome P450 2D6, anticorps cytochrome P450 2D6-like, anticorps CYP2D6, anticorps cyp2d6-b, anticorps cyp2d6.S, anticorps cyp2d6, anticorps LOC100988273

Sujet: Cytochrome P450 2D6 (CYP2D6) is one of the most important enzymes involved in the metabolism of xenobiotics in the body. It is a member of Cytochrome P450, family 2, subfamily D, polypeptide 6. This gene is mapped to chromosome 22q13.1. It has got 497 amino acid proteins which shares 73 % sequence identity with the rat protein. CYP2D6 is highly expressed in human liver and it is the major isozyme involved in the formation of N-hydroxyprocainamide, a metabolite potentially involved in the drug-induced lupus syndrome observed with procainamide.

UniProt: P10635