CYP2D6 anticorps (N-Term)

N° du produit ABIN630441

Détail du produit anti-CYP2D6 anticorps

Antigène: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP2D6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: CYP2 D6 antibody was raised against the N terminal of CYP2 6

Purification: Purified

Immunogène: CYP2 D6 antibody was raised using the N terminal of CYP2 6 corresponding to a region with amino acids RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP2D6 Blocking Peptide, catalog no. 33R-8102, is also available for use as a blocking control in assays to test for specificity of this CYP2D6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP2D6

Antigène: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Autre désignation: CYP2D6 (CYP2D6 Produits)

Synonymes: anticorps CPD6, anticorps CYP2D, anticorps CYP2D7AP, anticorps CYP2D7BP, anticorps CYP2D7P2, anticorps CYP2D8P2, anticorps CYP2DL1, anticorps CYPIID6, anticorps P450-DB1, anticorps P450C2D, anticorps P450DB1, anticorps CYP2D42, anticorps MGC64445, anticorps cyp2d2, anticorps cyp2d6-a, anticorps CYP2D6, anticorps cytochrome P450 family 2 subfamily D member 6, anticorps cytochrome P450, family 2, subfamily D, polypeptide 6, anticorps cytochrome 2D6, anticorps cytochrome P450 family 2 subfamily D member 6 S homeolog, anticorps cytochrome P450 2D6, anticorps cytochrome P450 2D6-like, anticorps CYP2D6, anticorps cyp2d6-b, anticorps cyp2d6.S, anticorps cyp2d6, anticorps LOC100988273

Sujet: CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug, sparteine and propafenone, both anti-arrythmic drugs, and amitryptiline, an anti-depressant.

Poids moléculaire: 55 kDa (MW of target protein)