CYP2D6 anticorps (N-Term)

N° du produit ABIN630441

Cet anticorps anti-CYP2D6 Polyclonal Lapin (ABIN630441) détecte spécifiquement CYP2D6 dans WB et IHC. L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour CYP2D6 anticorps (N-Term) (ABIN630441)

Antigène: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP2D6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-CYP2D6 anticorps

Épitope: N-Term

Specificité: CYP2 D6 antibody was raised against the N terminal of CYP2 6

Purification: Purified

Immunogène: CYP2 D6 antibody was raised using the N terminal of CYP2 6 corresponding to a region with amino acids RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP2D6 Blocking Peptide, (ABIN5613079), is also available for use as a blocking control in assays to test for specificity of this CYP2D6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP2D6

Antigène: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Autre désignation: CYP2D6

Sujet: CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug, sparteine and propafenone, both anti-arrythmic drugs, and amitryptiline, an anti-depressant.

Poids moléculaire: 55 kDa (MW of target protein)