ACADVL anticorps (AA 538-576)

N° du produit ABIN5647680

Cet anticorps Lapin Polyclonal détecte spécifiquement ACADVL dans WB, IF, IP, IHC (p) et FACS. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ACADVL anticorps (AA 538-576) (ABIN5647680)

Antigène: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACADVL est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunoprecipitation (IP), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Détail du produit anti-ACADVL anticorps

Épitope: AA 538-576

Fonction: ACADVL Antibody / VLCAD

Séquence: RALEQFATVV EAKLIKHKKG IVNEQFLLQR LADGAIDLY

Purification: Antigen affinity

Immunogène: Amino acids 538-576 (RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY) from the human protein were used as the immunogen for the ACADVL antibody.

Isotype: IgG

Information d'application

Indications d'application: Differences in protocols and secondary/substrate sensitivity may require the ACADVL antibody to be titrated for optimal performance.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the ACADVL antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur ACADVL

Antigène: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Autre désignation: ACADVL

Sujet: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (VLCAD) is an enzyme that in humans is encoded by the ACADVL gene. The protein encoded by this gene is targeted to the inner mitochondrial membrane, where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenaseis specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.

UniProt: P49748

Pathways: ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process