CXCR4 anticorps (AA 265-294)

N° du produit ABIN5647758

Cet anticorps Lapin Polyclonal détecte spécifiquement CXCR4 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour CXCR4 anticorps (AA 265-294) (ABIN5647758)

Antigène: CXCR4 (Chemokine (C-X-C Motif) Receptor 4 (CXCR4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CXCR4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CXCR4 anticorps

Épitope: AA 265-294

Purification: Antigen affinity purified

Immunogène: Amino acids 265-294 (ILLEIIKQGCEFENTVHKWISITEALAFFH) from the human protein were used as the immunogen for the CXCR4 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CXCR4 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the CXCR4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CXCR4

Antigène: CXCR4 (Chemokine (C-X-C Motif) Receptor 4 (CXCR4))

Autre désignation: CXCR4

Sujet: CXCR4 (Chemokine,CXC Motif, Receptor 4), also known as FUSIN or NPY3R, is a protein that in humans is encoded by the CXCR4 gene. It is the receptor for the CXC chemokine SDF1 that has essential functions on embryo organogenesis, immunological functions and T lymphocyte trafficking. CXCR4 is the only SDF1 receptor identified so far. This suggests that CXCR4 expression is critical for the biological effects of SDF1. CXCR4 is also a seven-transmembrane-spanning, G-protein-coupled receptor for the CXC chemokine PBSF/SDF-1. It functions as a co-receptor for T-cell-line tropic human immunodeficiency virus HIV-1. It was concluded that PBSF/SDF-1 and CXCR4 define a new signalling system for organ vascularization.

UniProt: P61073

Pathways: Regulation of Cell Size, CXCR4-mediated Signaling Events