IL-6 Receptor anticorps (AA 379-419)

N° du produit ABIN5647855

L’anticorps Lapin Polyclonal anti-IL-6 Receptor a été validé pour WB. Il convient pour détecter IL-6 Receptor dans des échantillons de Humain.

Aperçu rapide pour IL-6 Receptor anticorps (AA 379-419) (ABIN5647855)

Antigène: IL-6 Receptor (IL6R) (Interleukin 6 Receptor (IL6R))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL-6 Receptor est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IL-6 Receptor anticorps

Épitope: AA 379-419

Purification: Antigen affinity purified

Immunogène: Amino acids 379-419 (LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR) were used as the immunogen for the IL6R antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the IL6R antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the IL6R antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur IL-6 Receptor

Antigène: IL-6 Receptor (IL6R) (Interleukin 6 Receptor (IL6R))

Autre désignation: IL6R

Sujet: Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor. This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9.

UniProt: P08887

Pathways: Signalistation JAK/STAT, Autophagy, Growth Factor Binding, Cancer Immune Checkpoints