NADPH Oxidase 4 anticorps

N° du produit ABIN5692899

Détail du produit anti-NADPH Oxidase 4 anticorps

Antigène: NADPH Oxidase 4 (NOX4)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NADPH Oxidase 4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Marque: Picoband™

Séquence: ILNTLLDDWK PYKLRRLYFI WVCRDIQSFR WFADLL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for NADPH oxidase 4 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human NADPH oxidase 4 (ILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLL).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-NADPH Oxidase 4 (ABIN5692899)

Liu, Hong, Li, Ren, Wang, Xu, Shi, Xu: "A Cross Talk Between BRG1 and Males Absent on the First Contributes to Reactive Oxygen Species Production in a Mouse Model of Nonalcoholic Steatohepatitis." dans: Antioxidants & redox signaling, (2018) (PubMed).

Meyer, Fredette, Daniel, Sharma, Amann, Arterburn, Barton, Prossnitz: "Obligatory role for GPER in cardiovascular aging and disease." dans: Science signaling, Vol. 9, Issue 452, pp. ra105, (2017) (PubMed).

Détails sur NADPH Oxidase 4

Antigène: NADPH Oxidase 4 (NOX4)

Autre désignation: NOX4 (NOX4 Produits)

Synonymes: anticorps KOX, anticorps KOX-1, anticorps RENOX, anticorps AI648021, anticorps nox4, anticorps NOX4, anticorps NADPH oxidase 4, anticorps NOX4, anticorps Nox4, anticorps nox4, anticorps PTRG_09562

Sujet:

Synonyms: NADPH oxidase 4, Kidney oxidase-1, KOX-1, Kidney superoxide-producing NADPH oxidase, Renal NAD(P)H-oxidase, NOX4, RENOX

Tissue Specificity: Expressed by distal tubular cells in kidney cortex and in endothelial cells (at protein level). Widely expressed. Strongly expressed in kidney and to a lower extent in heart, adipocytes, hepatoma, endothelial cells, skeletal muscle, brain, several brain tumor cell lines and airway epithelial cells.

Background: NADPH oxidase 4 is an enzyme that in humans is encoded by the NOX4 gene, and is a member of the NOX family of NADPH oxidases. This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.

Pathways: Carbohydrate Homeostasis, Smooth Muscle Cell Migration