Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

CCKBR anticorps

CCKBR Reactivité: Humain, Rat, Souris WB, ICC, FACS, IHC (fro) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN5692993
  • Antigène Voir toutes CCKBR Anticorps
    CCKBR (Cholecystokinin B Receptor (CCKBR))
    Reactivité
    • 28
    • 20
    • 20
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Humain, Rat, Souris
    Hôte
    • 42
    • 1
    Lapin
    Clonalité
    • 43
    Polyclonal
    Conjugué
    • 18
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp CCKBR est non-conjugé
    Application
    • 27
    • 13
    • 13
    • 12
    • 8
    • 5
    • 3
    • 2
    • 2
    • 1
    • 1
    Western Blotting (WB), Immunocytochemistry (ICC), Flow Cytometry (FACS), Immunohistochemistry (Frozen Sections) (IHC (fro))
    Marque
    Picoband™
    Séquence
    PVYTVVQPVG PRVLQCVHRW PSARVRQTWS
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for CCKBR detection. Tested with WB, IHC-F, ICC, FCM in Human,Mouse,Rat.
    Immunogène
    A synthetic peptide corresponding to a sequence of human CCKBR (PVYTVVQPVGPRVLQCVHRWPSARVRQTWS).
  • Indications d'application

    Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(F) and ICC.

    Application Details: Western blot, 0.1-0.5 μg/mL
    Immunohistochemistry(Frozen Section), 0.5-1 μg/mL, Human
    Immunocytochemistry, 0.5-1 μg/mL, Human
    Flow Cytometry, 1-3 μg/1x106 cells, Human

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Buffer
    Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Stock
    4 °C,-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
  • Li, Huang, Liu: "Changes in FABP1 and gastrin receptor expression in the testes of rats that have undergone electrical injury." dans: Experimental and therapeutic medicine, Vol. 9, Issue 6, pp. 2155-2158, (2015) (PubMed).

  • Antigène
    CCKBR (Cholecystokinin B Receptor (CCKBR))
    Autre désignation
    CCKBR (CCKBR Produits)
    Synonymes
    anticorps CCKBR, anticorps LOC100232835, anticorps CCK-B, anticorps CCK2R, anticorps GASR, anticorps Cck2r, anticorps Cholrec, anticorps CCKR-2, anticorps CCK-BR, anticorps CCK2-R, anticorps CCK-CHR, anticorps cholecystokinin B receptor, anticorps cholecystokinin receptor-like, anticorps CCKBR, anticorps LOC100232835, anticorps Cckbr
    Sujet

    Synonyms: Gastrin/cholecystokinin type B receptor, CCK-B receptor, CCK-BR, Cholecystokinin-2 receptor, CCK2-R, CCKBR, CCKRB

    Tissue Specificity: Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the small cell lung cancer cell line NCI-H510, at lower levels in NCI-H345, NCI-H69 and GLC-28 cell lines, not expressed in GLC-19 cell line. Within the stomach, expressed at high levels in the mucosa of the gastric fundus and at low levels in the antrum and duodenum. Isoform 2 is present in pancreatic cancer cells and colorectal cancer cells, but not in normal pancreas or colonic mucosa. Isoform 3 is expressed in brain, pancreas, stomach, the stomach cancer cell line AGS and the colon cancer cell line LoVo.

    Background: The cholecystokinin B receptor, also known as CCKBR or CCK2, is a protein that in humans is encoded by the CCKBR gene. This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCK analogs and is found principally in the central nervous system and the gastrointestinal tract. Alternative splicing results in multiple transcript variants. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors.

    UniProt
    P32239
    Pathways
    Positive Regulation of Peptide Hormone Secretion, Feeding Behaviour
Vous êtes ici:
Support technique