Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

ErbB2/Her2 anticorps (AA 29-64)

L’anticorps anti-ErbB2/Her2 Polyclonal Lapin est utilisé pour la détection de ErbB2/Her2 dans des échantillons de Humain et Rat. Il a été validé pour WB et IHC (p).
N° du produit ABIN5708082
644,88 €
Plus frais de livraison 40,00 € et TVA
100 μg
Destination: France
Envoi sous 6 à 9 jours ouvrables

Aperçu rapide pour ErbB2/Her2 anticorps (AA 29-64) (ABIN5708082)

Antigène

Voir toutes ErbB2/Her2 Anticorps
ErbB2/Her2 (Receptor tyrosine-protein kinase erbB-2 (ErbB2/Her2))

Reactivité

  • 571
  • 125
  • 120
  • 33
  • 8
  • 5
  • 3
  • 3
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Humain, Rat

Hôte

  • 309
  • 211
  • 62
  • 10
  • 6
  • 3
  • 2
  • 2
  • 1
Lapin

Clonalité

  • 317
  • 283
  • 3
Polyclonal

Conjugué

  • 358
  • 28
  • 24
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 7
  • 7
  • 7
  • 7
  • 7
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 5
  • 5
  • 3
  • 2
  • 2
  • 1
  • 1
Cet anticorp ErbB2/Her2 est non-conjugé

Application

  • 320
  • 144
  • 138
  • 134
  • 132
  • 93
  • 80
  • 60
  • 58
  • 52
  • 49
  • 31
  • 30
  • 12
  • 9
  • 8
  • 5
  • 3
  • 3
  • 3
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
  • Épitope

    • 42
    • 39
    • 34
    • 28
    • 25
    • 24
    • 22
    • 17
    • 17
    • 15
    • 13
    • 12
    • 9
    • 6
    • 5
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    AA 29-64

    Purification

    Antigen affinity purified

    Immunogène

    Amino acids 29-64 (TDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTY) from the human protein were used as the immunogen for the HER2 antibody.

    Isotype

    IgG
  • Indications d'application

    Optimal dilution of the HER2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

    Restrictions

    For Research Use only
  • Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Stock

    -20 °C

    Stockage commentaire

    After reconstitution, the HER2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Antigène

    ErbB2/Her2 (Receptor tyrosine-protein kinase erbB-2 (ErbB2/Her2))

    Autre désignation

    HER2 / ErbB 2

    Sujet

    Receptor tyrosine-protein kinase erbB-2, also known as CD340 (cluster of differentiation 340), proto-oncogene Neu, Erbb2 (rodent), or ERBB2 (human), is a protein that in humans is encoded by the ERBB2 gene. And it is also frequently called HER2 (from human epidermal growth factor receptor 2) or HER2/neu. This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

    UniProt

    P04626

    Pathways

    Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Skeletal Muscle Fiber Development
Vous êtes ici:
Chat with us!