IFNAR1 anticorps (AA 263-306)

N° du produit ABIN5708183

Cet anticorps Lapin Polyclonal détecte spécifiquement IFNAR1 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour IFNAR1 anticorps (AA 263-306) (ABIN5708183)

Antigène: IFNAR1 (Interferon alpha/beta Receptor 1 (IFNAR1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFNAR1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IFNAR1 anticorps

Épitope: AA 263-306

Fonction: IFNAR1 Antibody / Interferon alpha receptor 1

Séquence: HAFLKRNPGN HLYKWKQIPD CENVKTTQCV FPQNVFQKGI YLLR

Purification: Antigen affinity

Immunogène: Amino acids 263-306 (HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR) from the human protein were used as the immunogen for the IFNAR1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the IFNAR1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the IFNAR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur IFNAR1

Antigène: IFNAR1 (Interferon alpha/beta Receptor 1 (IFNAR1))

Autre désignation: IFNAR1

Sujet: Interferon-alpha/beta receptor alpha chain is a protein that in humans is encoded by the IFNAR1 gene. The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor.

UniProt: P17181

Pathways: Signalistation JAK/STAT, Hepatitis C