PML anticorps (AA 140-177)

N° du produit ABIN5708267

Cet anticorps Lapin Polyclonal détecte spécifiquement PML dans WB et IHC (p). Il présente une réactivité envers Souris.

Aperçu rapide pour PML anticorps (AA 140-177) (ABIN5708267)

Antigène: PML (Promyelocytic Leukemia (PML))

Reactivité: Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PML est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-PML anticorps

Épitope: AA 140-177

Purification: Antigen affinity purified

Immunogène: Amino acids 140-177 (LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN) from the mouse protein were used as the immunogen for the PML antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the PML antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur PML

Antigène: PML (Promyelocytic Leukemia (PML))

Autre désignation: PML / Promyelocytic leukemia protein

Sujet: Promyelocytic leukemia protein functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes, including tumor suppression, transcriptional regulation, apoptosis, senescence, DNA damage response, and viral defense mechanisms.

UniProt: Q60953

Pathways: Signalisation p53, Retinoic Acid Receptor Signaling Pathway, Maintenance of Protein Location, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus