RUNX2 anticorps (Middle Region)
-
- Antigène Voir toutes RUNX2 Anticorps
- RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RUNX2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RUNX2 antibody was raised against the middle region of RUNX2
- Purification
- Purified
- Immunogène
- RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM
- Top Product
- Discover our top product RUNX2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RUNX2 Blocking Peptide, catalog no. 33R-2188, is also available for use as a blocking control in assays to test for specificity of this RUNX2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUNX2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))
- Autre désignation
- RUNX2 (RUNX2 Produits)
- Synonymes
- anticorps AML3, anticorps CBF-alpha-1, anticorps CBFA1, anticorps CCD, anticorps CCD1, anticorps CLCD, anticorps OSF-2, anticorps OSF2, anticorps PEA2aA, anticorps PEBP2aA, anticorps Cbf, anticorps Cbfa-1, anticorps Cbfa1, anticorps LS3, anticorps Osf2, anticorps Pebp2a1, anticorps Pebpa2a, anticorps runx2, anticorps RUNX2, anticorps ccd, anticorps aml3, anticorps ccd1, anticorps osf2, anticorps cbfa1, anticorps pea2aa, anticorps pebp2a1, anticorps pebp2a2, anticorps pebp2aa, anticorps pebp2aa1, anticorps runt related transcription factor 2, anticorps runt-related transcription factor 2a, anticorps runt-related transcription factor 2, anticorps runt related transcription factor 2 L homeolog, anticorps RUNX2, anticorps runx2a, anticorps Runx2, anticorps runx2, anticorps LOC703331, anticorps LOC100549663, anticorps runx2.L
- Sujet
- RUNX2 is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis, acting as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants, encoding different protein isoforms, result from alternate promoter use as well as alternate splicing.
- Poids moléculaire
- 57 kDa (MW of target protein)
-