CBS anticorps (N-Term)

N° du produit ABIN629598

Cet anticorps anti-CBS est un anticorps Lapin Polyclonal détectant CBS dans WB et IHC. Adapté pour Humain, Souris, Rat et Chien. Ce Primary Antibody a été cité dans 1 publication.

Aperçu rapide pour CBS anticorps (N-Term) (ABIN629598)

Antigène: CBS (Cystathionine-beta-Synthase (CBS))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CBS est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-CBS anticorps

Épitope: N-Term

Specificité: CBS antibody was raised against the N terminal of CBS

Purification: Purified

Immunogène: CBS antibody was raised using the N terminal of CBS corresponding to a region with amino acids RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CBS Blocking Peptide, (ABIN5612699), is also available for use as a blocking control in assays to test for specificity of this CBS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-CBS (ABIN629598)

Veerareddy, Dao, Yun, Stokes, Disbrow, Kevil, Cvek, Trutschl, Kilgore, Ramanathan, Zivadinov, Alexander: "Dysregulated Sulfide Metabolism in Multiple Sclerosis: Serum and Vascular Endothelial Inflammatory Responses." dans: Pathophysiology : the official journal of the International Society for Pathophysiology, Vol. 29, Issue 3, pp. 570-582, (2022) (PubMed).

Détails sur CBS

Antigène: CBS (Cystathionine-beta-Synthase (CBS))

Autre désignation: CBS

Sujet: CBS is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.

Poids moléculaire: 60 kDa (MW of target protein)