RAD23A anticorps

N° du produit ABIN629610

Cet anticorps anti-RAD23A est un anticorps Lapin Polyclonal détectant RAD23A dans WB et IHC. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour RAD23A anticorps (ABIN629610)

Antigène: RAD23A (RAD23 Homolog A (RAD23A))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAD23A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RAD23A anticorps

Purification: Purified

Immunogène: RAD23 A antibody was raised using a synthetic peptide corresponding to a region with amino acids GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAD23A Blocking Peptide, (ABIN938725), is also available for use as a blocking control in assays to test for specificity of this RAD23A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAD23A

Antigène: RAD23A (RAD23 Homolog A (RAD23A))

Autre désignation: RAD23A

Sujet: RAD23A is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Réparation de l'ADN