RAD23A anticorps
-
- Antigène Voir toutes RAD23A Anticorps
- RAD23A (RAD23 Homolog A (RAD23A))
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RAD23A est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- RAD23 A antibody was raised using a synthetic peptide corresponding to a region with amino acids GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ
- Top Product
- Discover our top product RAD23A Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RAD23A Blocking Peptide, catalog no. 33R-3339, is also available for use as a blocking control in assays to test for specificity of this RAD23A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RAD23A (RAD23 Homolog A (RAD23A))
- Autre désignation
- RAD23A (RAD23A Produits)
- Synonymes
- anticorps rad23a, anticorps wu:fe11h06, anticorps zgc:92001, anticorps RAD23A, anticorps HHR23A, anticorps HR23A, anticorps 2310040P19Rik, anticorps AL024030, anticorps mHR23A, anticorps RAD23 homolog A, nucleotide excision repair protein a, anticorps RAD23 homolog A, nucleotide excision repair protein, anticorps rad23aa, anticorps RAD23A, anticorps Rad23a
- Sujet
- RAD23A is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair.
- Poids moléculaire
- 40 kDa (MW of target protein)
- Pathways
- Réparation de l'ADN
-