ACTN2 anticorps (C-Term)

N° du produit ABIN629641

Cet anticorps Lapin Polyclonal détecte spécifiquement ACTN2 dans WB et IHC. Il présente une réactivité envers Humain, Souris, Rat et Chien et a été mentionné dans 1 publication.

Aperçu rapide pour ACTN2 anticorps (C-Term) (ABIN629641)

Antigène: ACTN2 (Actinin, alpha 2 (ACTN2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTN2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ACTN2 anticorps

Épitope: C-Term

Specificité: Alpha Actinin 2 antibody was raised against the C terminal of ACTN2

Purification: Purified

Immunogène: alpha Actinin 2 antibody was raised using the C terminal of ACTN2 corresponding to a region with amino acids VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Alpha Actinin 2 Blocking Peptide, (ABIN5612032), is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-ACTN2 (ABIN629641)

Chopra, Kutys, Zhang, Polacheck, Sheng, Luu, Eyckmans, Hinson, Seidman, Seidman, Chen: "Force Generation via β-Cardiac Myosin, Titin, and α-Actinin Drives Cardiac Sarcomere Assembly from Cell-Matrix Adhesions." dans: Developmental cell, Vol. 44, Issue 1, pp. 87-96.e5, (2018) (PubMed).

Détails sur ACTN2

Antigène: ACTN2 (Actinin, alpha 2 (ACTN2))

Autre désignation: alpha Actinin 2

Sujet: The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres. Murine Actn2 and Actn3 are differentially expressed, spatially and temporally, during embryonic development and, in contrast to humans, alpha-actinin-2 expression does not completely overlap alpha-actinin-3 in postnatal skeletal muscle, suggesting independent function.

Poids moléculaire: 98 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Skeletal Muscle Fiber Development, Negative Regulation of Transporter Activity