UBE2N anticorps

N° du produit ABIN629720

L’anticorps anti-UBE2N Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de UBE2N dans des échantillons provenant de Humain, Rat, Souris, Poisson zèbre (Danio rerio), Chien et Drosophila melanogaster. }

Aperçu rapide pour UBE2N anticorps (ABIN629720)

Antigène: UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))

Reactivité: Humain, Rat, Souris, Poisson zèbre (Danio rerio), Chien, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2N est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UBE2N anticorps

Purification: Purified

Immunogène: UBE2 N antibody was raised using a synthetic peptide corresponding to a region with amino acids GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2N Blocking Peptide, (ABIN938918), is also available for use as a blocking control in assays to test for specificity of this UBE2N antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2N

Antigène: UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))

Autre désignation: UBE2N

Sujet: UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: TCR Signaling, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades, Positive Regulation of Response to DNA Damage Stimulus, Ubiquitin Proteasome Pathway