UBE2N anticorps

N° du produit ABIN629730

Cet anticorps anti-UBE2N Polyclonal Lapin (ABIN629730) détecte spécifiquement UBE2N dans WB. L’anticorps est réactif avec des échantillons de Humain, Rat, Souris, Poisson zèbre (Danio rerio), Chien et Drosophila melanogaster.

Aperçu rapide pour UBE2N anticorps (ABIN629730)

Antigène: UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))

Reactivité: Humain, Rat, Souris, Poisson zèbre (Danio rerio), Chien, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2N est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UBE2N anticorps

Purification: Purified

Immunogène: UBE2 N antibody was raised using a synthetic peptide corresponding to a region with amino acids VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2N Blocking Peptide, (ABIN5616876), is also available for use as a blocking control in assays to test for specificity of this UBE2N antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2N

Antigène: UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))

Autre désignation: UBE2N

Sujet: UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: TCR Signaling, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades, Positive Regulation of Response to DNA Damage Stimulus, Ubiquitin Proteasome Pathway