PFKL anticorps (Middle Region)

N° du produit ABIN629821

Cet anticorps Lapin Polyclonal détecte spécifiquement PFKL dans WB. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour PFKL anticorps (Middle Region) (ABIN629821)

Antigène: PFKL (Phosphofructokinase, Liver (PFKL))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PFKL est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PFKL anticorps

Épitope: Middle Region

Specificité: PFKL antibody was raised against the middle region of PFKL

Purification: Purified

Immunogène: PFKL antibody was raised using the middle region of PFKL corresponding to a region with amino acids RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PFKL Blocking Peptide, (ABIN5615326), is also available for use as a blocking control in assays to test for specificity of this PFKL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFKL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PFKL

Antigène: PFKL (Phosphofructokinase, Liver (PFKL))

Autre désignation: PFKL

Sujet: Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit.

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, L'effet Warburg