14-3-3 zeta anticorps (C-Term)

N° du produit ABIN629824

Cet anticorps Lapin Polyclonal détecte spécifiquement 14-3-3 zeta dans WB. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour 14-3-3 zeta anticorps (C-Term) (ABIN629824)

Antigène: 14-3-3 zeta (YWHAZ)

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp 14-3-3 zeta est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-14-3-3 zeta anticorps

Épitope: C-Term

Specificité: YWHAZ antibody was raised against the C terminal of YWHAZ

Purification: Purified

Immunogène: YWHAZ antibody was raised using the C terminal of YWHAZ corresponding to a region with amino acids AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

YWHAZ Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YWHAZ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur 14-3-3 zeta

Antigène: 14-3-3 zeta (YWHAZ)

Autre désignation: YWHAZ

Sujet: YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Apoptose, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location