14-3-3 zeta anticorps (C-Term)

N° du produit ABIN629824

Détail du produit anti-14-3-3 zeta anticorps

Antigène: 14-3-3 zeta (YWHAZ)

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp 14-3-3 zeta est non-conjugé

Application: Western Blotting (WB)

Specificité: YWHAZ antibody was raised against the C terminal of YWHAZ

Purification: Purified

Immunogène: YWHAZ antibody was raised using the C terminal of YWHAZ corresponding to a region with amino acids AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

YWHAZ Blocking Peptide, catalog no. 33R-1158, is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YWHAZ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur 14-3-3 zeta

Antigène: 14-3-3 zeta (YWHAZ)

Autre désignation: YWHAZ (YWHAZ Produits)

Synonymes: anticorps 14-3-3-zeta, anticorps KCIP-1, anticorps YWHAD, anticorps 14-3-3zeta, anticorps Ywhaz, anticorps ACYPI003154, anticorps 14-3-3z, anticorps kcip-1, anticorps ywhaq, anticorps 1433z, anticorps ywhaz, anticorps ywhazb, anticorps 1110013I11Rik, anticorps AI596267, anticorps AL022924, anticorps AU020854, anticorps ywhaza, anticorps fb14h09, anticorps wu:fb05g08, anticorps wu:fb14h09, anticorps ywhai, anticorps zgc:55807, anticorps 14-3-3, anticorps 14-3-3 zeta, anticorps 14-3-3ZETA, anticorps 14-3-3leo, anticorps 2G1, anticorps 4-3-3 zeta, anticorps 5.11, anticorps 549, anticorps BEST:GH05075, anticorps CG17870, anticorps D14-3-3, anticorps D14-3-3zeta, anticorps Dmel\\CG17870, anticorps K, anticorps LEO, anticorps Leo, anticorps PAR-5, anticorps PAR5, anticorps Par-5, anticorps d14-3-3zeta, anticorps l(2)07103, anticorps l(2)46CFe, anticorps l(2)46Ee, anticorps leo, anticorps par-5, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta, anticorps 14-3-3 protein zeta, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta, anticorps tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog, anticorps 14-3-3 protein zeta/delta pseudogene, anticorps CG17870 gene product from transcript CG17870-RE, anticorps YWHAZ, anticorps 14-3-3zeta, anticorps ywhaz, anticorps 1433z, anticorps ywhaz.L, anticorps Ywhaz, anticorps ywhaz.S, anticorps LOC100855903

Sujet: YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Apoptose, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location