BRK1 anticorps (Middle Region)

N° du produit ABIN629872

Cet anticorps Lapin Polyclonal détecte spécifiquement BRK1 dans IHC et WB. Il présente une réactivité envers Humain, Souris, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour BRK1 anticorps (Middle Region) (ABIN629872)

Antigène: BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BRK1 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Détail du produit anti-BRK1 anticorps

Épitope: Middle Region

Specificité: C3 ORF10 antibody was raised against the middle region of C3 rf10

Purification: Purified

Immunogène: C3 ORF10 antibody was raised using the middle region of C3 rf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C3ORF10 Blocking Peptide, (ABIN936099), is also available for use as a blocking control in assays to test for specificity of this C3ORF10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BRK1

Antigène: BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))

Autre désignation: C3ORF10

Sujet: C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.

Poids moléculaire: 9 kDa (MW of target protein)

Pathways: Signalisation RTK