DRB1 anticorps (N-Term)

N° du produit ABIN629925

Cet anticorps anti-DRB1 est un anticorps Lapin Polyclonal détectant DRB1 dans WB. Adapté pour Chien, Humain, Souris et Rat.

Aperçu rapide pour DRB1 anticorps (N-Term) (ABIN629925)

Antigène: DRB1 (Dopamine Receptor Binding 1 (DRB1))

Reactivité: Chien, Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DRB1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DRB1 anticorps

Épitope: N-Term

Specificité: DRB1 antibody was raised against the N terminal of DRB1

Purification: Purified

Immunogène: DRB1 antibody was raised using the N terminal of DRB1 corresponding to a region with amino acids MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DRB1 Blocking Peptide, (ABIN5613263), is also available for use as a blocking control in assays to test for specificity of this DRB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DRB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DRB1

Antigène: DRB1 (Dopamine Receptor Binding 1 (DRB1))

Autre désignation: DRB1

Sujet: DRB1 is RNA-binding protein with binding specificity for poly(C) and may play an important role in neural development.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: TCR Signaling, Positive Regulation of Peptide Hormone Secretion, Production of Molecular Mediator of Immune Response, CXCR4-mediated Signaling Events