PABPC4 anticorps (N-Term)

N° du produit ABIN629988

Détail du produit anti-PABPC4 anticorps

Antigène: PABPC4 (Poly(A) Binding Protein, Cytoplasmic 4 (Inducible Form) (PABPC4))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PABPC4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: PABPC4 antibody was raised against the N terminal of PABPC4

Purification: Purified

Immunogène: PABPC4 antibody was raised using the N terminal of PABPC4 corresponding to a region with amino acids AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKS

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PABPC4 Blocking Peptide, catalog no. 33R-1137, is also available for use as a blocking control in assays to test for specificity of this PABPC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PABPC4

Antigène: PABPC4 (Poly(A) Binding Protein, Cytoplasmic 4 (Inducible Form) (PABPC4))

Autre désignation: PABPC4 (PABPC4 Produits)

Synonymes: anticorps cb12, anticorps sb:cb12, anticorps PABP, anticorps ePAB, anticorps ePABP, anticorps APP-1, anticorps APP1, anticorps PABP4, anticorps iPABP, anticorps polyadenylate-binding protein 4, anticorps poly(A) binding protein, cytoplasmic 4, anticorps poly(A) binding protein, cytoplasmic 4 (inducible form), anticorps poly(A) binding protein cytoplasmic 4 L homeolog, anticorps poly(A) binding protein cytoplasmic 4, anticorps Bm1_06880, anticorps Pabpc4, anticorps pabpc4, anticorps pabpc4.L, anticorps PABPC4

Sujet: Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 mRNA levels in T cells approximately 5-fold. PABPC4 contains 4 RNA-binding domains and proline-rich C terminus. PABPC4 is localized primarily to the cytoplasm. It is suggested that PABPC4 might be necessary for regulation of stability of labile mRNA species in activated T cells.

Poids moléculaire: 71 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome