LARP7 anticorps (C-Term)

N° du produit ABIN630024

Détail du produit anti-LARP7 anticorps

Antigène: LARP7 (La Ribonucleoprotein Domain Family, Member 7 (LARP7))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LARP7 est non-conjugé

Application: Western Blotting (WB)

Specificité: LARP7 antibody was raised against the C terminal of LARP7

Purification: Purified

Immunogène: LARP7 antibody was raised using the C terminal of LARP7 corresponding to a region with amino acids HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LARP7 Blocking Peptide, catalog no. 33R-3703, is also available for use as a blocking control in assays to test for specificity of this LARP7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LARP7

Antigène: LARP7 (La Ribonucleoprotein Domain Family, Member 7 (LARP7))

Autre désignation: LARP7 (LARP7 Produits)

Synonymes: anticorps ALAZS, anticorps PIP7S, anticorps LARP7, anticorps C330027G06Rik, anticorps D3Wsu161e, anticorps fa10g04, anticorps wu:fa10g04, anticorps zgc:56476, anticorps La ribonucleoprotein domain family member 7, anticorps La ribonucleoprotein domain family, member 7, anticorps la-related protein 7, anticorps La ribonucleoprotein domain family, member 7-like, anticorps LARP7, anticorps Larp7, anticorps larp7, anticorps LOC100222278, anticorps LOC100627397

Sujet: LARP7 is a negative transcriptional regulator of polymerase II genes, acting by means of the 7SK RNP system. Within the 7SK RNP complex, the positive transcription elongation factor b (P-TEFb) is sequestered in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Chromatin Binding, SARS-CoV-2 Protein Interactome, Phosphorylation & l'infection par le SRAS-CoV-2