KCTD6 anticorps (N-Term)

N° du produit ABIN630063

Cet anticorps anti-KCTD6 est un anticorps Polyclonal produit chez le Lapin, détectant KCTD6 dans WB. Convient pour Humain, Souris et Rat.

Aperçu rapide pour KCTD6 anticorps (N-Term) (ABIN630063)

Antigène: KCTD6 (Potassium Channel Tetramerisation Domain Containing 6 (KCTD6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCTD6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KCTD6 anticorps

Épitope: N-Term

Specificité: KCTD6 antibody was raised against the N terminal of KCTD6

Purification: Purified

Immunogène: KCTD6 antibody was raised using the N terminal of KCTD6 corresponding to a region with amino acids LRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVV

Information d'application

Indications d'application: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCTD6 Blocking Peptide, (ABIN5614310), is also available for use as a blocking control in assays to test for specificity of this KCTD6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCTD6

Antigène: KCTD6 (Potassium Channel Tetramerisation Domain Containing 6 (KCTD6))

Autre désignation: KCTD6

Sujet: KCTD6 is a domain of potassium channel

Poids moléculaire: 26 kDa (MW of target protein)