CATSPER2 anticorps (C-Term)

N° du produit ABIN630073

Cet anticorps Lapin Polyclonal détecte spécifiquement CATSPER2 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour CATSPER2 anticorps (C-Term) (ABIN630073)

Antigène: CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CATSPER2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CATSPER2 anticorps

Épitope: C-Term

Specificité: CATSPER2 antibody was raised against the C terminal of CATSPER2

Purification: Purified

Immunogène: CATSPER2 antibody was raised using the C terminal of CATSPER2 corresponding to a region with amino acids LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDK

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CATSPER2 Blocking Peptide, (ABIN5612686), is also available for use as a blocking control in assays to test for specificity of this CATSPER2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CATSPER2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CATSPER2

Antigène: CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))

Autre désignation: CATSPER2

Sujet: Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. This gene is part of a tandem repeat on chromosome 15q14, the second copy of this gene is thought to be a pseudogene. Additional splice variants have been described but their full-length nature has not been determined.

Poids moléculaire: 58 kDa (MW of target protein)