ASIC3 anticorps (N-Term)

N° du produit ABIN630092

L’anticorps Lapin Polyclonal anti-ASIC3 a été validé pour WB et IHC. Il convient pour détecter ASIC3 dans des échantillons de Humain.

Aperçu rapide pour ASIC3 anticorps (N-Term) (ABIN630092)

Antigène: ASIC3 (ACCN3) (Amiloride-Sensitive Cation Channel 3 (ACCN3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASIC3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ASIC3 anticorps

Épitope: N-Term

Specificité: ACCN3 antibody was raised against the N terminal of ACCN3

Purification: Purified

Immunogène: ACCN3 antibody was raised using the N terminal of ACCN3 corresponding to a region with amino acids VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACCN3 Blocking Peptide, (ABIN5611892), is also available for use as a blocking control in assays to test for specificity of this ACCN3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASIC3

Antigène: ASIC3 (ACCN3) (Amiloride-Sensitive Cation Channel 3 (ACCN3))

Autre désignation: ACCN3

Sujet: ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing.

Poids moléculaire: 58 kDa (MW of target protein)