Glypican 3 anticorps (Middle Region)

N° du produit ABIN630140

L’anticorps Lapin Polyclonal anti-Glypican 3 a été validé pour WB. Il convient pour détecter Glypican 3 dans des échantillons de Humain, Rat, Souris et Chien.

Aperçu rapide pour Glypican 3 anticorps (Middle Region) (ABIN630140)

Antigène: Glypican 3 (GPC3)

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Glypican 3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Glypican 3 anticorps

Épitope: Middle Region

Specificité: GPC3 antibody was raised against the middle region of GPC3

Purification: Purified

Immunogène: GPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPC3 Blocking Peptide, (ABIN938466), is also available for use as a blocking control in assays to test for specificity of this GPC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Glypican 3

Antigène: Glypican 3 (GPC3)

Autre désignation: GPC3

Sujet: Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process