Glypican 3 anticorps (Middle Region)
-
- Antigène Voir toutes Glypican 3 (GPC3) Anticorps
- Glypican 3 (GPC3)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Glypican 3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GPC3 antibody was raised against the middle region of GPC3
- Purification
- Purified
- Immunogène
- GPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
- Top Product
- Discover our top product GPC3 Anticorps primaire
-
anti-Glypican 3 (GPC3) antibody
GPC3 Reactivité: Humain, Souris FACS, WB, IHC, ELISA, ICC Hôte: Souris Monoclonal 9C2 unconjugated
anti-Glypican 3 (GPC3) (AA 344-559) antibodyGPC3 Reactivité: Souris WB, IHC, ICC, IP Hôte: Lapin Polyclonal unconjugated
anti-Glypican 3 (GPC3) (AA 55-200) antibodyGPC3 Reactivité: Humain FACS, WB, IHC, ELISA Hôte: Souris Monoclonal 2A2C3 unconjugated
anti-Glypican 3 (GPC3) (AA 359-554) antibodyGPC3 Reactivité: Humain FACS, WB, IHC, ELISA Hôte: Souris Monoclonal 2C7E9 unconjugated
anti-Glypican 3 (GPC3) antibodyGPC3 Reactivité: Humain, Rat IF, FACS, IHC, StM Hôte: Souris Monoclonal GPC3-863 unconjugated
anti-Glypican 3 (GPC3) (AA 55-200) antibodyGPC3 Reactivité: Humain IF, FACS, WB, IHC, ELISA, IHC (p) Hôte: Souris Monoclonal 9C2 unconjugated
anti-Glypican 3 (GPC3) (AA 21-50), (N-Term) antibodyGPC3 Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal RB05031 unconjugated
anti-Glypican 3 (GPC3) (AA 359-554) antibodyGPC3 Reactivité: Humain, Rat FACS, WB, ELISA Hôte: Souris Monoclonal 4D5B1 unconjugated
anti-Glypican 3 (GPC3) antibodyGPC3 Reactivité: Humain, Rat IF, FACS, IHC, StM Hôte: Souris Monoclonal rGPC3-863 unconjugated Recombinant Antibody
anti-Glypican 3 (GPC3) (AA 511-580) antibodyGPC3 Reactivité: Humain IF, FACS, WB, IHC, StM Hôte: Souris Monoclonal 1G12 unconjugated
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GPC3 Blocking Peptide, catalog no. 33R-3080, is also available for use as a blocking control in assays to test for specificity of this GPC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Glypican 3 (GPC3)
- Autre désignation
- GPC3 (GPC3 Produits)
- Synonymes
- anticorps GPC3, anticorps sgb, anticorps dgsx, anticorps sdys, anticorps sgbs, anticorps oci-5, anticorps sgbs1, anticorps DGSX, anticorps GTR2-2, anticorps MXR7, anticorps OCI-5, anticorps SDYS, anticorps SGB, anticorps SGBS, anticorps SGBS1, anticorps Glypican-3, anticorps glypican 3, anticorps gpc3, anticorps GPC3, anticorps Gpc3
- Sujet
- Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.
- Poids moléculaire
- 64 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-
