FEN1 anticorps (C-Term)

N° du produit ABIN630178

Cet anticorps Lapin Polyclonal détecte spécifiquement FEN1 dans WB. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour FEN1 anticorps (C-Term) (ABIN630178)

Antigène: FEN1 (Flap Structure-Specific Endonuclease 1 (FEN1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FEN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FEN1 anticorps

Épitope: C-Term

Specificité: FEN1 antibody was raised against the C terminal of FEN1

Purification: Purified

Immunogène: FEN1 antibody was raised using the C terminal of FEN1 corresponding to a region with amino acids PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FEN1 Blocking Peptide, (ABIN5613568), is also available for use as a blocking control in assays to test for specificity of this FEN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FEN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FEN1

Antigène: FEN1 (Flap Structure-Specific Endonuclease 1 (FEN1))

Autre désignation: FEN1

Sujet: FEN1 removes 5' overhanging flaps in DNA repair and processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excision repair provides coordinated loading of the proteins onto the substrate, thus passing the substrate from one enzyme to another. The protein is a member of the XPG/RAD2 endonuclease family and is one of ten proteins essential for cell-free DNA replication. DNA secondary structure can inhibit flap processing at certain trinucleotide repeats in a length-dependent manner by concealing the 5' end of the flap that is necessary for both binding and cleavage by the protein encoded by this gene. Therefore, secondary structure can deter the protective function of this protein, leading to site-specific trinucleotide expansions.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Telomere Maintenance, Réparation de l'ADN, DNA Replication, Synthesis of DNA