RNASEH2A anticorps (Middle Region)

N° du produit ABIN630199

Cet anticorps Lapin Polyclonal détecte spécifiquement RNASEH2A dans WB et IHC. Il présente une réactivité envers Humain et Poisson zèbre (Danio rerio).

Aperçu rapide pour RNASEH2A anticorps (Middle Region) (ABIN630199)

Antigène: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Reactivité: Humain, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNASEH2A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RNASEH2A anticorps

Épitope: Middle Region

Specificité: RNASEH2 A antibody was raised against the middle region of RNASEH2

Purification: Purified

Immunogène: RNASEH2 A antibody was raised using the middle region of RNASEH2 corresponding to a region with amino acids AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNASEH2A Blocking Peptide, (ABIN936844), is also available for use as a blocking control in assays to test for specificity of this RNASEH2A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNASEH2A

Antigène: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Autre désignation: RNASEH2A

Sujet: Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.

Poids moléculaire: 33 kDa (MW of target protein)