PIK3CB anticorps (C-Term)

N° du produit ABIN630206

Détail du produit anti-PIK3CB anticorps

Antigène: PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIK3CB est non-conjugé

Application: Western Blotting (WB)

Specificité: PIK3 CB antibody was raised against the C terminal of PIK3 B

Purification: Purified

Immunogène: PIK3 CB antibody was raised using the C terminal of PIK3 B corresponding to a region with amino acids VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIK3CB Blocking Peptide, catalog no. 33R-9615, is also available for use as a blocking control in assays to test for specificity of this PIK3CB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 B antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIK3CB

Antigène: PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))

Autre désignation: PIK3CB (PIK3CB Produits)

Synonymes: anticorps P110BETA, anticorps PI3K, anticorps PI3KBETA, anticorps PIK3C1, anticorps fb92a07, anticorps wu:fb92a07, anticorps 1110001J02Rik, anticorps AI447572, anticorps p110beta, anticorps PI3Kbeta, anticorps phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta, anticorps phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta, anticorps PIK3CB, anticorps pik3cb, anticorps Pik3cb

Sujet: Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110 kDa catalytic subunit, such as PIK3CB, and an 85 kDa adaptor subunit.

Poids moléculaire: 123 kDa (MW of target protein)