Glucagon anticorps (N-Term)

N° du produit ABIN630283

Cet anticorps Lapin Polyclonal détecte spécifiquement Glucagon dans WB. Il présente une réactivité envers Humain, Rat, Souris et Chien.

Aperçu rapide pour Glucagon anticorps (N-Term) (ABIN630283)

Antigène: Glucagon (GCG)

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Glucagon est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Glucagon anticorps

Épitope: N-Term

Specificité: Glucagon antibody was raised against the N terminal of GCG

Purification: Purified

Immunogène: Glucagon antibody was raised using the N terminal of GCG corresponding to a region with amino acids LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Glucagon Blocking Peptide, (ABIN5613789), is also available for use as a blocking control in assays to test for specificity of this Glucagon antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Glucagon antibody is supplied as lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Glucagon

Antigène: Glucagon (GCG)

Autre désignation: Glucagon

Sujet: GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Negative Regulation of intrinsic apoptotic Signaling