SLC1A5 anticorps

N° du produit ABIN630342

Cet anticorps anti-SLC1A5 est un anticorps Lapin Polyclonal détectant SLC1A5 dans WB et IHC. Adapté pour Humain, Souris, Rat et Chien. Ce Primary Antibody a été cité dans 1 publication.

Aperçu rapide pour SLC1A5 anticorps (ABIN630342)

Antigène: SLC1A5 (Solute Carrier Family 1 Member 5 (SLC1A5))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC1A5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SLC1A5 anticorps

Purification: Purified

Immunogène: SLC1 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC1A5 Blocking Peptide, (ABIN938301), is also available for use as a blocking control in assays to test for specificity of this SLC1A5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-SLC1A5 (ABIN630342)

Krämer, Gröner, Hoffmann, Craig, Brugger, Drzezga, Timmer, Neumaier, Zlatopolskiy, Endepols, Neumaier: "Evaluation of 3-l- and 3-d-[18F]Fluorophenylalanines as PET Tracers for Tumor Imaging." dans: Cancers, Vol. 13, Issue 23, (2021) (PubMed).

Détails sur SLC1A5

Antigène: SLC1A5 (Solute Carrier Family 1 Member 5 (SLC1A5))

Autre désignation: SLC1A5

Sujet: SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated amino acids, anionic amino acids, and cationic amino acids. It acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses.

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport, L'effet Warburg